DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS17 and mrps17

DIOPT Version :10

Sequence 1:NP_525119.1 Gene:mRpS17 / 37872 FlyBaseID:FBgn0034986 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001017055.1 Gene:mrps17 / 549809 XenbaseID:XB-GENE-5730000 Length:141 Species:Xenopus tropicalis


Alignment Length:97 Identity:32/97 - (32%)
Similarity:61/97 - (62%) Gaps:0/97 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LMGQCMPCIKQNASKIRIRRMELDKNLNMYFKKDEFYFAHDPQKVCKTGDVVLIRELPERLTRLI 72
            ::|:.:....:..:|:|:.|:.||..|..|:.|.:.|||||.|:.|..||:||::.||||.::.:
 Frog    13 IVGKVIGTKMRKTAKVRVTRLVLDPYLLKYYNKRKTYFAHDAQQQCTIGDIVLLKALPERRSKHV 77

  Fly    73 THNVEKVVYPLGDITDPLTGKKVVVGNYREDI 104
            .|.:.::::.:|.:.|||||::.....|.:.:
 Frog    78 KHELSEIIFKVGRVEDPLTGRRCAGSMYLDSL 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS17NP_525119.1 Ribosomal_uS17 <22..79 CDD:466775 24/56 (43%)
mrps17NP_001017055.1 Ribosomal_uS17 11..84 CDD:466775 25/70 (36%)

Return to query results.
Submit another query.