DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS17 and MRPS17

DIOPT Version :10

Sequence 1:NP_525119.1 Gene:mRpS17 / 37872 FlyBaseID:FBgn0034986 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_057053.1 Gene:MRPS17 / 51373 HGNCID:14047 Length:130 Species:Homo sapiens


Alignment Length:95 Identity:34/95 - (35%)
Similarity:55/95 - (57%) Gaps:0/95 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LMGQCMPCIKQNASKIRIRRMELDKNLNMYFKKDEFYFAHDPQKVCKTGDVVLIRELPERLTRLI 72
            ::|:.:....|..:|:|:.|:.||..|..||.|.:.|||||..:.|..||:||:|.||....:.:
Human    13 IVGKVIGTKMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTVGDIVLLRALPVPRAKHV 77

  Fly    73 THNVEKVVYPLGDITDPLTGKKVVVGNYRE 102
            .|.:.::|:.:|.:.||:|||......|.|
Human    78 KHELAEIVFKVGKVIDPVTGKPCAGTTYLE 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS17NP_525119.1 Ribosomal_uS17 <22..79 CDD:466775 23/56 (41%)
MRPS17NP_057053.1 Ribosomal_uS17 11..84 CDD:466775 25/70 (36%)

Return to query results.
Submit another query.