DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS17 and rps11

DIOPT Version :10

Sequence 1:NP_525119.1 Gene:mRpS17 / 37872 FlyBaseID:FBgn0034986 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_998542.1 Gene:rps11 / 406686 ZFINID:ZDB-GENE-040426-2701 Length:159 Species:Danio rerio


Alignment Length:89 Identity:23/89 - (25%)
Similarity:35/89 - (39%) Gaps:9/89 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRRGLLLMGQCMPCIKQNASKIRIRRMELDKNLNMYFKKDEFYFAH-DPQKVC----KTGDVVL 60
            :|.||.:|.|.......|....||...:...:..|.:.|:.:....| .|   |    ..||:|.
Zfish    67 VSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSP---CFRDVTVGDIVT 128

  Fly    61 IRELPERLTRLITHNVEKVVYPLG 84
            :.|. ..|::.:..||.||....|
Zfish   129 VGEC-RPLSKTVRFNVLKVTKAAG 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS17NP_525119.1 Ribosomal_uS17 <22..79 CDD:466775 14/61 (23%)
rps11NP_998542.1 PTZ00241 1..159 CDD:240326 23/89 (26%)

Return to query results.
Submit another query.