DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS17 and rps1102

DIOPT Version :10

Sequence 1:NP_525119.1 Gene:mRpS17 / 37872 FlyBaseID:FBgn0034986 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_594672.1 Gene:rps1102 / 2542904 PomBaseID:SPAC144.11 Length:152 Species:Schizosaccharomyces pombe


Alignment Length:81 Identity:22/81 - (27%)
Similarity:34/81 - (41%) Gaps:2/81 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRRGLLLMGQCMPCIKQNASKIRIRRMELDKNLNMYFKKDEFYFAH-DPQKVCKTGDVVLIREL 64
            :|.||.:|.|..:.........||...:......|.|.|:.:...|| .|......||||.:.:.
pombe    61 VSIRGRILTGTVVSTKMHRTIIIRREYLHFIPKYNRYEKRHKNLAAHVSPAFRINEGDVVTVGQC 125

  Fly    65 PERLTRLITHNVEKVV 80
             ..|::.:..||.:||
pombe   126 -RPLSKTVRFNVLRVV 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS17NP_525119.1 Ribosomal_uS17 <22..79 CDD:466775 15/57 (26%)
rps1102NP_594672.1 PTZ00241 7..152 CDD:240326 22/81 (27%)

Return to query results.
Submit another query.