DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNS1 and Shawl

DIOPT Version :9

Sequence 1:XP_016883335.1 Gene:KCNS1 / 3787 HGNCID:6300 Length:527 Species:Homo sapiens
Sequence 2:NP_001097131.2 Gene:Shawl / 5740840 FlyBaseID:FBgn0085395 Length:937 Species:Drosophila melanogaster


Alignment Length:520 Identity:143/520 - (27%)
Similarity:221/520 - (42%) Gaps:125/520 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    55 VNVGGVRRQLSARALARFPGTRLGRLQAAASEEQARRLCDDYDEAAREFYFDRHPGFFLSLLHFY 119
            :||.|:|.:.....|.:.|.|||.||..|.:         :||....|::||||||.|..:|::|
  Fly     9 LNVSGIRYETYKATLKKIPATRLSRLTEALA---------NYDPVLNEYFFDRHPGVFTQILNYY 64

Human   120 RTGHLHVLDELCVFAFGQEADYWGLGENALAACCRARYLERRLTQPHAWDEDSDTPSSVDPCPDE 184
            |||.||...::|...|.:|.::|||..|.:..||.:.|...|.||......|.....:..|..::
  Fly    65 RTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWSTYSIHRDTQNTLAILDKLDIENEKPTEEQ 129

Human   185 ISDV--QRELARYGAARC-GRLRRRLWLTMENPGYSLPSKLFSCVSISVVLASIAAMCIHSLPEY 246
            |:.:  ..|....|...| .|::.::|...:.|..|..:|:.:.:|:..:..|:.:.|:.:.|.:
  Fly   130 IARLFGFEEALSNGELNCWQRIKPKIWAMFDEPSSSTGAKIVAGMSVFFIFVSVISFCLKTHPGF 194

Human   247 QAREAAAAVAA--VAAGRSPEGVRDDPV------------------------------------- 272
            :....:.|..|  ..||..|.|  .||:                                     
  Fly   195 RVDLPSGAHDAHGPGAGGPPHG--HDPMGEPPQTHQYHQHSITPPSGSIGPTFRVTNYTSYSSGN 257

Human   273 --------------------LRR---------------------------------------LEY 278
                                |:|                                       :|.
  Fly   258 FTASGQATPIATIKGGQRQRLKRNINGSILNEFIEEKILGHNGRRKHGWIETYGQPHEAFFYVEL 322

Human   279 FCIAWFSFEVSSRLLLAPSTRNFFCHPLNLIDIVSVLPFYLTLLAGVALGDQGGKEFGHLGKVVQ 343
            .|..||..||..||:::|:...|...|:|:||..:.|.||..::          :..|....:::
  Fly   323 VCNVWFFIEVIIRLIVSPNLWQFIKSPVNIIDFTATLSFYTDVM----------QRMGEYTGLLE 377

Human   344 VFRLMRIFRVLKLARHSTGLRSLGATLKHSYREVGILLLYLAVGVSVFSGVAYTAEK---EEDVG 405
            .|.::||.|:.||.|||.|||.|..|.|.|.:|:.:|:.:|.:|:..|:.:||.|||   ..|..
  Fly   378 AFSIVRIMRLFKLTRHSPGLRILIHTFKASAKELTLLVFFLVLGIVFFASLAYYAEKLQDNPDNQ 442

Human   406 FNTIPACWWWGTVSMTTVGYGDVVPVTVAGKLAASGCILGGILVVALPITIIFNKFSHFYRRQKA 470
            |.:||...||..|:|||||||||.|.|..|....:.|.|.|:|.:|||:.:|.:.||.||...:|
  Fly   443 FKSIPLGLWWAIVTMTTVGYGDVAPKTYPGMFVGALCALAGVLTIALPVPVIVSNFSMFYSHTQA 507

Human   471  470
              Fly   508  507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNS1XP_016883335.1 None
ShawlNP_001097131.2 BTB 7..99 CDD:197585 37/98 (38%)
BTB_2 7..97 CDD:280393 36/96 (38%)
Ion_trans 307..506 CDD:278921 75/208 (36%)
Ion_trans_2 <449..499 CDD:285168 23/49 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D818306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.