DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-60 and JEM1

DIOPT Version :10

Sequence 1:NP_523840.1 Gene:DnaJ-60 / 37869 FlyBaseID:FBgn0260775 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_012462.3 Gene:JEM1 / 853372 SGDID:S000003609 Length:645 Species:Saccharomyces cerevisiae


Alignment Length:112 Identity:36/112 - (32%)
Similarity:58/112 - (51%) Gaps:16/112 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NDKPRKPETHYEVLNIRNDCSTREVRNAFVQLSKLYHPD-VKSNAACPERTAR--FVQISEAYKT 79
            |..|:|  .:|::|.:....|::|:|.|::.|:|.|||| :|:|....:.:..  ..||:|||:|
Yeast   532 NYDPKK--DYYKILGVSPSASSKEIRKAYLNLTKKYHPDKIKANHNDKQESIHETMSQINEAYET 594

  Fly    80 LIKPERRRDYDDSLLWQPSRSDRSPVGETVNPGQAWDVRPNYDPNPG 126
            |...::|::||  |.....|.:..|.|...|         |...|||
Yeast   595 LSDDDKRKEYD--LSRSNPRRNTFPQGPRQN---------NMFKNPG 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-60NP_523840.1 DnaJ 26..90 CDD:395170 22/66 (33%)
JEM1NP_012462.3 DnaJ 538..>613 CDD:440252 25/76 (33%)

Return to query results.
Submit another query.