DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-60 and DNAJC30

DIOPT Version :10

Sequence 1:NP_523840.1 Gene:DnaJ-60 / 37869 FlyBaseID:FBgn0260775 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_115693.2 Gene:DNAJC30 / 84277 HGNCID:16410 Length:226 Species:Homo sapiens


Alignment Length:100 Identity:35/100 - (35%)
Similarity:49/100 - (49%) Gaps:15/100 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YEVLNIRNDCSTREVRNAFVQLSKLYHPDVKSNAACPERTARFVQISEAYKTLIKPERRRDYDDS 92
            |::|.:.:..:..:::.|:.:...|||||..|.:|  |...||.:||:||..|.....||.||..
Human    51 YDLLGVPSTATQAQIKAAYYRQCFLYHPDRNSGSA--EAAERFTRISQAYVVLGSATLRRKYDRG 113

  Fly    93 LLWQPSRSDRSPVGETVNPGQAWDVRPNYDPNPGP 127
            ||     ||....|    ||    |||:..|.|.|
Human   114 LL-----SDEDLRG----PG----VRPSRTPAPDP 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-60NP_523840.1 DnaJ 26..90 CDD:395170 20/61 (33%)
DNAJC30NP_115693.2 DnaJ 50..111 CDD:395170 20/61 (33%)
PRK14299 51..>173 CDD:237667 34/99 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..157 10/27 (37%)

Return to query results.
Submit another query.