DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-60 and AT5G59610

DIOPT Version :10

Sequence 1:NP_523840.1 Gene:DnaJ-60 / 37869 FlyBaseID:FBgn0260775 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001330548.1 Gene:AT5G59610 / 836080 AraportID:AT5G59610 Length:279 Species:Arabidopsis thaliana


Alignment Length:93 Identity:29/93 - (31%)
Similarity:47/93 - (50%) Gaps:8/93 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RKPETHYEVLNIRNDCSTREVRNAFVQLSKLYHPDVKSNAACPERTARFVQISEAYKTLIKPERR 86
            |...:.||:|.:....:.::::.|:.:|:..|||||...|...|   :|::|..||.|||..:.|
plant    69 RARSSPYEILGVSPSATPQDIKRAYRKLALKYHPDVNKEANAQE---KFLKIKHAYTTLINSDSR 130

  Fly    87 RDYDDSLLWQPSRSDRSPVGETVNPGQA 114
            |.|...     ||:..|..|:|...|.:
plant   131 RKYGSD-----SRATGSSTGQTSRKGNS 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-60NP_523840.1 DnaJ 26..90 CDD:395170 21/63 (33%)
AT5G59610NP_001330548.1 DnaJ 73..133 CDD:395170 21/62 (34%)
terminal_TopJ 75..>266 CDD:468284 28/87 (32%)

Return to query results.
Submit another query.