DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-60 and ATJ6

DIOPT Version :10

Sequence 1:NP_523840.1 Gene:DnaJ-60 / 37869 FlyBaseID:FBgn0260775 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_196308.1 Gene:ATJ6 / 830582 AraportID:AT5G06910 Length:284 Species:Arabidopsis thaliana


Alignment Length:99 Identity:27/99 - (27%)
Similarity:44/99 - (44%) Gaps:12/99 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NDKPRKPETHYEVLNIRNDCSTREVRNAFVQLSKLYHPDVKSNAACPERTARFVQISEAYKTLIK 82
            |..|....:.||||.:....:::|:|.|:.:|:...|||  .|....|...:|.|:.:....|..
plant    21 NAGPSSETSLYEVLGVERRATSQEIRKAYHKLALKLHPD--KNQDDKEAKDKFQQLQKVISILGD 83

  Fly    83 PERRRDYDDSLLWQPSRSDRSPVGETVNPGQAWD 116
            .|:|..||     |....|.:.:     ||.|::
plant    84 EEKRAVYD-----QTGSIDDADI-----PGDAFE 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-60NP_523840.1 DnaJ 26..90 CDD:395170 18/63 (29%)
ATJ6NP_196308.1 DnaJ 29..91 CDD:395170 18/63 (29%)

Return to query results.
Submit another query.