DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-60 and Csp

DIOPT Version :10

Sequence 1:NP_523840.1 Gene:DnaJ-60 / 37869 FlyBaseID:FBgn0260775 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster


Alignment Length:77 Identity:20/77 - (25%)
Similarity:37/77 - (48%) Gaps:7/77 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DKPRKPETH----YEVLNIRNDCSTREVRNAFVQLSKLYHPDVKSNAACPERTARFVQISEAYKT 79
            || ||..|.    ||:|.:....:..:::..:.:|:..||||  .|....:...:|.:::.|:..
  Fly     7 DK-RKLSTSGDSLYEILGLPKTATGDDIKKTYRKLALKYHPD--KNPDNVDAADKFKEVNRAHSI 68

  Fly    80 LIKPERRRDYDD 91
            |....:|..||:
  Fly    69 LSDQTKRNIYDN 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-60NP_523840.1 DnaJ 26..90 CDD:395170 14/67 (21%)
CspNP_730713.1 DnaJ 17..79 CDD:395170 13/63 (21%)

Return to query results.
Submit another query.