DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-60 and Dnajc24

DIOPT Version :10

Sequence 1:NP_523840.1 Gene:DnaJ-60 / 37869 FlyBaseID:FBgn0260775 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001178782.1 Gene:Dnajc24 / 362184 RGDID:1564710 Length:148 Species:Rattus norvegicus


Alignment Length:68 Identity:20/68 - (29%)
Similarity:34/68 - (50%) Gaps:6/68 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YEVLNIRNDCSTREVRNAFVQLSKLYHPDVKSNAACP-----ERTARFVQISEAYKTLIKPERRR 87
            |.:|.........:::..:.:|..||||| |.:|..|     |...:|::|.:|:|.|...|.::
  Rat    12 YSILGADPSADVSDLKQKYQKLILLYHPD-KQSADVPAGTMEECVQKFIEIDQAWKILGNEETKK 75

  Fly    88 DYD 90
            .||
  Rat    76 KYD 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-60NP_523840.1 DnaJ 26..90 CDD:395170 18/66 (27%)
Dnajc24NP_001178782.1 DnaJ 10..78 CDD:395170 18/66 (27%)
zf-CSL 94..147 CDD:398744
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.