DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANAT1 and CG31248

DIOPT Version :9

Sequence 1:NP_995934.1 Gene:AANAT1 / 37867 FlyBaseID:FBgn0019643 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001262333.1 Gene:CG31248 / 40853 FlyBaseID:FBgn0051248 Length:251 Species:Drosophila melanogaster


Alignment Length:234 Identity:36/234 - (15%)
Similarity:88/234 - (37%) Gaps:57/234 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DCPYTIELIQPEDGEAVIAMLKTFFFKDEPLNTFLDLGECKELEKYSLKPLPDN----------C 108
            |..:.:..:...|.|..:.:|...||.:|.:....::.            ||:|          |
  Fly    14 DGKFEVRSVTHSDLEEALDVLDGSFFLNESVCVACEIN------------LPENRQARLDLRELC 66

  Fly   109 SYKAVN---------KKGEIIGVFLNGLMRRPSPDD---VPEKAADSCEHPKFKKILSLMDHVEE 161
            ...|::         ..|.::.|..|.:...|.|.:   ..:...:..:.|:.::::..|..|:.
  Fly    67 RKTALDGVSLLVKEADTGRVVSVSFNKIQYAPPPGEDHFFLKFRNEEVKSPQARRLMDFMIEVDG 131

  Fly   162 QFNI---FDVYPDEELILDGKILSVDTNYRGLGIAGRLTERAYEYMRE----NGIN--------- 210
            :.::   |::....||:    .|:...::..||:...|::...|..:|    .|:.         
  Fly   132 RIDVCAMFNMVCFCELM----FLATLPSHERLGLGRSLSQFTIELTKELAEGKGLEDIDDKLRSK 192

  Fly   211 ---VYHVLCSSHYSARVMEKLGFHEVFRMQFADYKPQGE 246
               ....|.:|.:|.:|.:...|..:..:.:::::.:|:
  Fly   193 RPAAVTALWTSRFSQKVGKATDFKVINTVSYSEFEYKGK 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANAT1NP_995934.1 RimI <168..235 CDD:223532 14/82 (17%)
NAT_SF <183..227 CDD:302625 10/59 (17%)
CG31248NP_001262333.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435040
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.