DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANAT1 and R05H10.7

DIOPT Version :9

Sequence 1:NP_995934.1 Gene:AANAT1 / 37867 FlyBaseID:FBgn0019643 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001022271.1 Gene:R05H10.7 / 3565038 WormBaseID:WBGene00011046 Length:226 Species:Caenorhabditis elegans


Alignment Length:181 Identity:44/181 - (24%)
Similarity:73/181 - (40%) Gaps:17/181 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LIQPEDGEAVIAMLKTFFFKDEPLNTFLDL--GECKEL-EKYSLKPLPDNCSYKAVNKKGEIIGV 122
            |.:..|...|:..|...:|..||....|.|  .|.:.| |....:.|....|.....:.|||:..
 Worm     9 LAKKSDAPDVLNFLLEHYFPLEPCTRALKLIKSEAEVLYESLVARCLQFPFSTVVTTQSGEIVAC 73

  Fly   123 FLNGLMRRPSPDDVPEKA---ADSCEHPKFKKILSLMDHVEEQFNIFDVYPDE-ELILDGKILSV 183
            .:|...:|  .|:..|.|   .|..........:.:::...|.|  :::.|.. .::|..::.||
 Worm    74 LVNSAWKR--DDNAVEGADYEVDEGLTENMTAFIKMLNTCHEDF--WNLAPQNINVVLHREVSSV 134

  Fly   184 DTNYRGLGIAGRL--TERAYEYMRENGIN-VYHVLCSSHYSARV-MEKLGF 230
            ...|:..|||.::  |......:.|..|: |....||  :..:| :||.||
 Worm   135 SEKYQRRGIATKMLTTNMPKAKLDEYSIDGVLSETCS--FGNQVLLEKHGF 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANAT1NP_995934.1 RimI <168..235 CDD:223532 19/68 (28%)
NAT_SF <183..227 CDD:302625 12/47 (26%)
R05H10.7NP_001022271.1 Acetyltransf_7 <134..184 CDD:316066 16/52 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160155940
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I4040
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185856at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.090

Return to query results.
Submit another query.