DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANAT1 and AANATL2

DIOPT Version :9

Sequence 1:NP_995934.1 Gene:AANAT1 / 37867 FlyBaseID:FBgn0019643 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001285667.1 Gene:AANATL2 / 33874 FlyBaseID:FBgn0031791 Length:216 Species:Drosophila melanogaster


Alignment Length:221 Identity:71/221 - (32%)
Similarity:99/221 - (44%) Gaps:28/221 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 TIELIQPEDGEAVIAMLKTFFFKDEPLNTFLDLGECKELEKYSLKP------LPDNCSYKAVNKK 116
            ||..:...|.|.|.|.|...|||.||| ..:...:.|:.|..|.:.      :|.:.|..||:  
  Fly     5 TIRAMTIGDYEEVEAFLAVHFFKQEPL-MLIPQEDPKQSEVSSAEAELHRSLIPQDLSLVAVD-- 66

  Fly   117 GE-IIGVFLNGLMRRPSPDDVPEKAADSCEHPKFKKILSLMDH-------VEEQFNIFDVYPDEE 173
            || |:||.|.|.:       |||......:..:.|:|..|:|.       :|.|.|||..|..|.
  Fly    67 GERIVGVVLAGEL-------VPEDLEREYQEAEQKEITCLLDKIHKFLAGIERQANIFKHYGVER 124

  Fly   174 -LILDGKILSVDTNYRGLGIAGRLTERAYEYMRENGINVYHVLCSSHYSARVMEKLGFHEVFRMQ 237
             |.|  .:|.||.:.|...:..||.|...|..|:.|..|....||:..|.|:|..|....:....
  Fly   125 ALYL--YMLGVDVSIRRQRVGTRLVEATIELGRQRGFPVVTSTCSNQNSKRLMTALNMECILTKD 187

  Fly   238 FADYKPQ-GEVVFKPAAPHVGIQVMA 262
            :||||.: ||:|.:.:.||....|:|
  Fly   188 YADYKDEHGEIVLRASEPHTSASVVA 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANAT1NP_995934.1 RimI <168..235 CDD:223532 21/67 (31%)
NAT_SF <183..227 CDD:302625 15/43 (35%)
AANATL2NP_001285667.1 NAT_SF 114..163 CDD:173926 18/50 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435023
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185856at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.