DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANAT1 and AgmNAT

DIOPT Version :9

Sequence 1:NP_995934.1 Gene:AANAT1 / 37867 FlyBaseID:FBgn0019643 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_572268.1 Gene:AgmNAT / 31512 FlyBaseID:FBgn0029813 Length:216 Species:Drosophila melanogaster


Alignment Length:220 Identity:57/220 - (25%)
Similarity:99/220 - (45%) Gaps:19/220 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ACPVDQDCPYTIELIQPEDGEAVIAMLKTFFFKDEPLNTFLDLGECKELEK-YSLKPLPDNCSYK 111
            |.|:..|  ..:..:...:.|.::..|...::.:|||.......|.:..:| :.|..:|....:.
  Fly     2 AKPIADD--IVVRQVDVGETEQLMTFLLAHYYPEEPLTAGTHPPEPEAADKEFLLSNVPFGTCFV 64

  Fly   112 AVNKKGEIIGVFLNGLMRRPSPDDVPEKAADSCEH---PKFKKILSLMDHVEEQFNI---FDVYP 170
            |:: :|.|:...:.|    |.....||..|:....   .|:..||.|:..||...::   |.| |
  Fly    65 ALH-EGRIVAAVVAG----PKDSHEPEHMAEEARKYAGGKWGSILHLLSAVETATDVCRRFSV-P 123

  Fly   171 DEELILDGKILSVDTNYRGLGIAGRLTERAYEYMRENGINVYHVLCSSHYSARVMEKLGFHEVFR 235
            .   .|....|.||...||..:.|||.|...:..|:.|..:..|.|:|.||||::::||:..:..
  Fly   124 S---CLHVHALGVDPQLRGRNLGGRLMETVAQRGRDLGHQLVSVDCTSVYSARLVQRLGYQLINT 185

  Fly   236 MQFADY-KPQGEVVFKPAAPHVGIQ 259
            :::.|: ...|:.|.:|..||..:|
  Fly   186 LRYVDHLDASGQQVIRPPPPHESVQ 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANAT1NP_995934.1 RimI <168..235 CDD:223532 23/66 (35%)
NAT_SF <183..227 CDD:302625 17/43 (40%)
AgmNATNP_572268.1 Acetyltransf_1 33..180 CDD:306954 44/155 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435026
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185856at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.