DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANAT1 and W02D7.5

DIOPT Version :9

Sequence 1:NP_995934.1 Gene:AANAT1 / 37867 FlyBaseID:FBgn0019643 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_505143.2 Gene:W02D7.5 / 189117 WormBaseID:WBGene00020941 Length:232 Species:Caenorhabditis elegans


Alignment Length:210 Identity:48/210 - (22%)
Similarity:72/210 - (34%) Gaps:38/210 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 QPEDGEAVIAMLKTFFFKDEPLNTFLDLGECKELEKYSLKPLPDNC-----SYKAVNKKGEIIGV 122
            ||:|.|.::..|...|.|:||....|.|.  .|..:.........|     |...:.:..||...
 Worm    18 QPKDKENILKFLDAHFAKEEPCARALKLS--PETSRGIFTTTVTRCLNFPFSTVVLQENDEIAAC 80

  Fly   123 FLNGLMRRPSPDD--------VPEKAA-----DSCEHPKFKKILSLMDHVEEQFNIFDVYPDEEL 174
            .|..:..|..|.|        :||...     .:..|..|.||..               |:...
 Worm    81 LLASVWNRTDPIDSADFNSSGMPENLKLFVQFINSAHSNFWKIAP---------------PNVNS 130

  Fly   175 ILDGKILSVDTNYRGLGIAGRLTERAYEYMRENGINVYHVL--CSSHYSARVMEKLGFHEVFRMQ 237
            |:..:|.||...:...|||.|:.............|:..||  .||..:..|::|.||..:..:.
 Worm   131 IIHREIGSVAPQFTRKGIATRMVTTNMTKTNLKKYNIGGVLSETSSLANQIVLQKAGFKCLKELP 195

  Fly   238 F-ADYKPQGEVVFKP 251
            : |....:|..|.:|
 Worm   196 YSAIVDSKGNRVLRP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANAT1NP_995934.1 RimI <168..235 CDD:223532 18/68 (26%)
NAT_SF <183..227 CDD:302625 11/45 (24%)
W02D7.5NP_505143.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I4040
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185856at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.160

Return to query results.
Submit another query.