DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANAT1 and R13D11.4

DIOPT Version :9

Sequence 1:NP_995934.1 Gene:AANAT1 / 37867 FlyBaseID:FBgn0019643 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_503329.2 Gene:R13D11.4 / 187863 WormBaseID:WBGene00020058 Length:227 Species:Caenorhabditis elegans


Alignment Length:205 Identity:43/205 - (20%)
Similarity:78/205 - (38%) Gaps:32/205 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 YTIELIQPEDGEAVIAMLKTFFFKDEPLNTFLDLGECKELEKYSLKPLPDNC---------SYKA 112
            |....:..|:...:...|.:.|..:||:|..:.      :.:.:.:|..|..         |:..
 Worm     6 YEFVQLTNENSSELSEFLMSHFLLEEPMNRAIG------MSRENFQPFVDKLFERTLNIPFSFAL 64

  Fly   113 VNKKGEIIGVFLNGLMRRPSPDDVPEKAADSCEH--------PKFKKILS---LMDHVEEQFNIF 166
            |.|............:.....:||..|  |:..|        |:.|.|.:   ::..:..:|  |
 Worm    65 VEKDSRKFAACAMSSLWINEKNDVAHK--DTENHGDEFTFGNPERKDIAAVGKILTELHGKF--F 125

  Fly   167 DVYPDEELILDGKILSVDTNYRGLGIAGRLTERAYE--YMRENGINVYHVLCSSHYSARVMEKLG 229
            ::..|.|..|..:||||...::..|:|.||..:..:  .|||...:......||..:..:|:|.|
 Worm   126 EICLDVEQALHLEILSVAKEHQRRGLASRLMAKMEDPAKMREFKCSKIASEISSLANQCLMKKRG 190

  Fly   230 FHEVFRMQFA 239
            :..:....||
 Worm   191 YTALTETLFA 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANAT1NP_995934.1 RimI <168..235 CDD:223532 19/68 (28%)
NAT_SF <183..227 CDD:302625 11/45 (24%)
R13D11.4NP_503329.2 Acetyltransf_1 <130..191 CDD:366181 18/60 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I4040
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.