DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANAT1 and anat-1

DIOPT Version :9

Sequence 1:NP_995934.1 Gene:AANAT1 / 37867 FlyBaseID:FBgn0019643 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001076662.1 Gene:anat-1 / 177439 WormBaseID:WBGene00015938 Length:285 Species:Caenorhabditis elegans


Alignment Length:249 Identity:44/249 - (17%)
Similarity:91/249 - (36%) Gaps:48/249 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IARLTQKMEDALTVSGKPAACPVDQDCPYTIELIQPEDGEAVIAMLKTFFFKDEPLNTFLDLGEC 93
            |.|.:..|:.|...:.:.         .|.:|.::..:.|.::..|...|.:.|.:...|.:.: 
 Worm    44 IRRTSDSMKSANMTANRQ---------QYQVESVKESNLEEIVQFLIDNFAQTEAILASLKIDD- 98

  Fly    94 KELEKYSLKPL--------------PDNCSYKAVNKKGEIIGVFLNGLMRRPSPDDVPEKAADS- 143
               :|..||.|              ...|..:.|..: :|.|:.|      .....:.:|..|. 
 Worm    99 ---DKICLKELTVMLRDLVQDSLQCSSTCVIRDVTTR-QIDGIAL------ACKTSIFDKQIDRL 153

  Fly   144 CEHP-KFKKILSLMDHVEEQFNIFDV--YPDEELILDG---KILSVDTNYRGLGIAGRLTERAYE 202
            |.:. :.:::...::.::..||..||  |.:|..:...   .::.|.....|.||...|......
 Worm   154 CAYEFREQRVRDAVEFLKYVFNKLDVMYYLNEHRLYKPVFVALVCVRKELWGRGIGTTLMNHVKS 218

  Fly   203 YMRENGINVYHVLCSSHYSARVMEKLGFHEVFRMQFADYKPQGE-----VVFKP 251
            ..|.:..:....|||:....::|:.....:...:::..:|  ||     :|.:|
 Worm   219 AARTDSSDGLISLCSNERGHKLMKTYCPTDFAAVRYDAFK--GEHLRPPIVMRP 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANAT1NP_995934.1 RimI <168..235 CDD:223532 13/71 (18%)
NAT_SF <183..227 CDD:302625 10/43 (23%)
anat-1NP_001076662.1 NAT_SF <192..221 CDD:173926 5/28 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.