DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and PRY3

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_012457.1 Gene:PRY3 / 853367 SGDID:S000003614 Length:881 Species:Saccharomyces cerevisiae


Alignment Length:186 Identity:37/186 - (19%)
Similarity:61/186 - (32%) Gaps:78/186 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 DTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAATVSFMHSECRSTLRF 132
            |.|...|.||.:    .:|||            .|.|...||..|:.:|.             ::
Yeast    28 DVLNEHNKFRAL----HVDTA------------PLTWSDTLATYAQNYAD-------------QY 63

  Fly   133 PLAGEVLALSPPVGHRLSL----TELLRMVFAHIFDEYKTVQDPQSFARRFDSKRDY-------S 186
            ..:|.:.....|.|..|:|    |..:...:..|                  ||.:|       |
Yeast    64 DCSGVLTHSDGPYGENLALGYTDTGAVDAWYGEI------------------SKYNYSNPGFSES 110

  Fly   187 VGHFSIIVNDRVSRVGCGFAVGSNCEKDGKVGFC-----HFLTCHFDYTNVNGSYV 237
            .|||:.:|....:.:|||:.            :|     :::.|.:   |..|:|:
Yeast   111 TGHFTQVVWKSTAEIGCGYK------------YCGTTWNNYIVCSY---NPPGNYL 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 34/175 (19%)
PRY3NP_012457.1 CAP_PRY1-like 24..152 CDD:349403 37/186 (20%)
ser_rich_anae_1 <598..>855 CDD:411418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344581
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.