DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and PRY1

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_012456.1 Gene:PRY1 / 853366 SGDID:S000003615 Length:299 Species:Saccharomyces cerevisiae


Alignment Length:151 Identity:36/151 - (23%)
Similarity:52/151 - (34%) Gaps:34/151 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 NKTFPSAKRMRALQWDSELAYMARTHAATVSFMHSECRSTLRFPLAGEVLALSPPVGHRLSLTEL 154
            ||.....|...||.|...||..|:.:|.     :.:|..||...        ..|.|..|:|.  
Yeast   171 NKKRALHKDTPALSWSDTLASYAQDYAD-----NYDCSGTLTHS--------GGPYGENLALG-- 220

  Fly   155 LRMVFAHIFDEYKTVQDPQSFARRFD-SKRDYS--VGHFSIIVNDRVSRVGCGFAVGSNCEKDGK 216
                    :|....|....:....:| |...:|  .|||:.:|....::||||.........|  
Yeast   221 --------YDGPAAVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGD-- 275

  Fly   217 VGFCHFLTCHFDYT-NVNGSY 236
                 ::.|.:|.. |..|.|
Yeast   276 -----YVICSYDPAGNYEGEY 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 32/140 (23%)
PRY1NP_012456.1 CAP_PRY1-like 166..289 CDD:349403 34/147 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344539
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.