DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and CRISPLD2

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_113664.1 Gene:CRISPLD2 / 83716 HGNCID:25248 Length:497 Species:Homo sapiens


Alignment Length:199 Identity:41/199 - (20%)
Similarity:65/199 - (32%) Gaps:67/199 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 PSAKRMRALQWDSELAYMARTHAATVSFMHSECRSTLRFPLAGEVLALSPPVGHRLSLTELLRMV 158
            |.|..|..:.||.||...|...|:...:.|..             .:|...:|..|.        
Human    72 PQASNMEYMTWDDELEKSAAAWASQCIWEHGP-------------TSLLVSIGQNLG-------- 115

  Fly   159 FAHIFDEYKTVQDP----QSFARRFDSKRDYS-------------------VGHFSIIVNDRVSR 200
             || :..|::   |    ||:   :|..:||:                   ..|::.||....::
Human   116 -AH-WGRYRS---PGFHVQSW---YDEVKDYTYPYPSECNPWCPERCSGPMCTHYTQIVWATTNK 172

  Fly   201 VGCGFAVGSNCEKD---GKV--GFCHFLTCHFDYTNVNGSYVYKTGKATTGCNDWKTIASIKYSN 260
            :||..   :.|.|.   |:|  ...:|:..:....|..|...||.|:..:.|..       .|..
Human   173 IGCAV---NTCRKMTVWGEVWENAVYFVCNYSPKGNWIGEAPYKNGRPCSECPP-------SYGG 227

  Fly   261 LCEN 264
            .|.|
Human   228 SCRN 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 32/161 (20%)
CRISPLD2NP_113664.1 SCP_euk 56..201 CDD:240180 32/160 (20%)
LCCL 286..370 CDD:128866
LCCL 387..479 CDD:128866
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151221
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.