DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and Crispld1

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001343480.1 Gene:Crispld1 / 83691 MGIID:1934666 Length:500 Species:Mus musculus


Alignment Length:220 Identity:45/220 - (20%)
Similarity:70/220 - (31%) Gaps:92/220 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 NKTFPSAKRMRALQWDSELAYMARTHAATVSFMHSECRSTLRFPLAGEVLALSPPVGHRLSLTEL 154
            ::.:|:|..|..:.||.||...|.:.|....:.|...             :|.|.:|..|.    
Mouse    74 SQVYPTASNMEYMTWDVELERSAESWAEMCLWEHGPA-------------SLLPSIGQNLG---- 121

  Fly   155 LRMVFAHIFDEYKTVQDPQSFARR--FDSKRDYS-------------------VGHFSIIVNDRV 198
                 || :..|:    |.:|..:  :|..||:|                   ..|::.:|....
Mouse   122 -----AH-WGRYR----PPTFHVQAWYDEVRDFSYPYENECDPYCPFRCSGPVCTHYTQVVWATS 176

  Fly   199 SRVGCGFAVGSNCEKDGKVGFCH-------------FLTCHFD-YTNVNGSYVYKTGKATT---- 245
            ||:||.            |..||             :|.|::. ..|..|...||.|:..:    
Mouse   177 SRIGCA------------VNLCHNMNIWGQIWPKAVYLVCNYSPKGNWWGHAPYKHGRPCSACPP 229

  Fly   246 ----GCNDWKTIASIKYSNLCENTG 266
                ||.:          |||...|
Mouse   230 SFGGGCRE----------NLCYKEG 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 34/171 (20%)
Crispld1NP_001343480.1 CAP_CRISPLD1 62..207 CDD:349407 34/171 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..281
LCCL 291..375 CDD:128866
LCCL 394..492 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841235
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.