DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and CRISPLD1

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_113649.1 Gene:CRISPLD1 / 83690 HGNCID:18206 Length:500 Species:Homo sapiens


Alignment Length:319 Identity:61/319 - (19%)
Similarity:108/319 - (33%) Gaps:128/319 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSILLLA-GLLLLLLPMVAGYNYCNNRTHVCDLAQRKHFMCRLGE---LKPYGGRAKYYASIPD 61
            :|::|.:| .:..:::|         |.|.:..|.::  :|...||   .|..|.||     |.|
Human    11 VTTVLFMARAIPAMVVP---------NATLLEKLLEK--YMDEDGEWWIAKQRGKRA-----ITD 59

  Fly    62 TLKVRKDTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAATVSFMHSEC 126
                 .|..::|:....:         .::.:|:|..|..:.||.||...|.:.|.:..:.|...
Human    60 -----NDMQSILDLHNKL---------RSQVYPTASNMEYMTWDVELERSAESWAESCLWEHGPA 110

  Fly   127 RSTLRFPLAGEVLALSPPVGHRLSLTELLRMVFAHIFDEYKTVQDPQSFARR--FDSKRDYS--- 186
                         :|.|.:|..|.         || :..|:    |.:|..:  :|..:|:|   
Human   111 -------------SLLPSIGQNLG---------AH-WGRYR----PPTFHVQSWYDEVKDFSYPY 148

  Fly   187 ----------------VGHFSIIVNDRVSRVGCGFAVGSNCEKDGKVGFCH-------------F 222
                            ..|::.:|....:|:||.            :..||             :
Human   149 EHECNPYCPFRCSGPVCTHYTQVVWATSNRIGCA------------INLCHNMNIWGQIWPKAVY 201

  Fly   223 LTCHFD-YTNVNGSYVYKTGKATT--------GCNDWKTIASIKYSNLC--ENTGEIFP 270
            |.|::. ..|..|...||.|:..:        ||.:          |||  |.:...:|
Human   202 LVCNYSPKGNWWGHAPYKHGRPCSACPPSFGGGCRE----------NLCYKEGSDRYYP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 33/195 (17%)
CRISPLD1NP_113649.1 SCP_euk 63..207 CDD:240180 32/191 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..281
LCCL 291..375 CDD:128866
LCCL 392..483 CDD:128866
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151158
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.