DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and AT5G02730

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_195893.1 Gene:AT5G02730 / 831820 AraportID:AT5G02730 Length:205 Species:Arabidopsis thaliana


Alignment Length:241 Identity:51/241 - (21%)
Similarity:76/241 - (31%) Gaps:74/241 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLLAGLLLLLLPMVAGYNYCNNRTHVCDLAQRKHFMCRLGELKPYGGRAKYYASIPDTLKVRKDT 69
            |.::.:|||||.:.:                        ||.....|     .|.|||   :...
plant    12 LSISSVLLLLLLIFS------------------------GEFPSTAG-----TSSPDT---KAAA 44

  Fly    70 LAVLNTFRDMLAGGELDTAENKTFPSAKRMRA----LQWDSELAYMARTHAATVSFMHSECRSTL 130
            ....|..|......|...|.|     |.|:.:    |:||..||..|...|..   ..|:|:.|.
plant    45 ARATNRGRRNKQSAEFLLAHN-----AARVASGASNLRWDQGLARFASKWAKQ---RKSDCKMTH 101

  Fly   131 RFPLAGEVLALSPPVGHRLSLTELLRMVFAHIFDEYKTVQDPQSFARRFD-----SKRDYSVGHF 190
            .....||               .:.|...:..:...:.|......:..:|     .|.....||:
plant   102 SGGPYGE---------------NIFRYQRSENWSPRRVVDKWMDESLNYDRVANTCKSGAMCGHY 151

  Fly   191 SIIVNDRVSRVGCGFAVGSNCEKDGKVGFCHFLTCHFDYTNVNGSY 236
            :.||....:.|||   ..|.|  |...||  .:.|.:   :.:|:|
plant   152 TQIVWRTTTAVGC---ARSKC--DNNRGF--LVICEY---SPSGNY 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 36/170 (21%)
AT5G02730NP_195893.1 SCP_PR-1_like 57..193 CDD:240181 36/164 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.