DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and AT4G30320

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_194761.1 Gene:AT4G30320 / 829155 AraportID:AT4G30320 Length:161 Species:Arabidopsis thaliana


Alignment Length:131 Identity:33/131 - (25%)
Similarity:56/131 - (42%) Gaps:22/131 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 RMRALQWDSELAYMARTHAATVSFMHSECRSTLRFPLAGEVLALSPPVGHRLSLTELLRMVFAHI 162
            |::.|:||::||..|:..|   :....:|..|......||.|....  |:|...::.        
plant    42 RLKPLKWDAKLARYAQWWA---NQRRGDCALTHSNGPYGENLFWGS--GNRWGPSQA-------- 93

  Fly   163 FDEYKTVQDPQSFARRFDSKRDYSVGHFSIIVNDRVSRVGCGFAVGSNCEKDGKVGFCHFLTCHF 227
              .|..:.:.:|:..|.:|......||::.||.....::||...:   |...|.|    ||||::
plant    94 --AYGWLSEARSYNYRSNSCNSEMCGHYTQIVWKNTQKIGCAHVI---CNGGGGV----FLTCNY 149

  Fly   228 D 228
            |
plant   150 D 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 32/129 (25%)
AT4G30320NP_194761.1 CAP_PR-1 27..161 CDD:349400 33/131 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.