DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and AT3G19690

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_188603.1 Gene:AT3G19690 / 821506 AraportID:AT3G19690 Length:161 Species:Arabidopsis thaliana


Alignment Length:196 Identity:42/196 - (21%)
Similarity:73/196 - (37%) Gaps:65/196 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 AKYYASIPDTLKVRKDTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHA- 116
            |.:|.|:.:.|  ::..|...|..|:.:.   ||              .|.||.|:|..|.::| 
plant    15 ALFYGSLAEDL--QQQFLEAHNEARNEVG---LD--------------PLVWDDEVAAYAASYAN 60

  Fly   117 ---ATVSFMHSECRSTLRFPLAGEVLALSPPVGHRLSLT--ELLRMVFAHIFDEYKTVQDPQSFA 176
               ...:.:||                 :.|.|..::::  |:.....|.::...|...|     
plant    61 QRINDCALVHS-----------------NGPFGENIAMSSGEMSAEDAAEMWINEKQYYD----- 103

  Fly   177 RRFDSK--RDYSVG---HFSIIVNDRVSRVGCGFAVGSNCEKDGKVGFCHFLTCHFDYTNVNGSY 236
              :||.  .|.:.|   |::.:|.....|:||...|   |...|.     |:||::|   ..|:|
plant   104 --YDSNTCNDPNGGTCLHYTQVVWKNTVRLGCAKVV---CNSGGT-----FITCNYD---PPGNY 155

  Fly   237 V 237
            :
plant   156 I 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 35/172 (20%)
AT3G19690NP_188603.1 CAP_PR-1 26..161 CDD:349400 38/183 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.