DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and PR-1-LIKE

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_179589.1 Gene:PR-1-LIKE / 816518 AraportID:AT2G19990 Length:176 Species:Arabidopsis thaliana


Alignment Length:206 Identity:47/206 - (22%)
Similarity:72/206 - (34%) Gaps:84/206 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GELKPYGGRAKYYASIPDTLKVRKDTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSEL 108
            |::||                  ::||.|.|..|.|:..|                 .:.|:..|
plant    38 GDVKP------------------QETLVVHNKARAMVGVG-----------------PMVWNETL 67

  Fly   109 AYMARTHAATVSFMHSECRS-TLRFPLA--GEVLA-----LSPPVGHRLSLTELLRMVFAHIFDE 165
            |..|:::|      |...|. .::..|.  ||.||     :|.||.....:||            
plant    68 ATYAQSYA------HERARDCAMKHSLGPFGENLAAGWGTMSGPVATEYWMTE------------ 114

  Fly   166 YKTVQDPQSFARRFDSKR---DYSVGHFSIIV-NDRVSRVGCGFAVGSNCEKDGKVGFCHFLTCH 226
             |...|       :||..   |...||::.|| .|.| |:||   ....|:.|..:    ::.|.
plant   115 -KENYD-------YDSNTCGGDGVCGHYTQIVWRDSV-RLGC---ASVRCKNDEYI----WVICS 163

  Fly   227 FDYTNVNGSYV 237
            :|   ..|:|:
plant   164 YD---PPGNYI 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 41/173 (24%)
PR-1-LIKENP_179589.1 CAP_PR-1 42..176 CDD:349400 45/202 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.