DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and AT2G19980

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_179588.1 Gene:AT2G19980 / 816517 AraportID:AT2G19980 Length:165 Species:Arabidopsis thaliana


Alignment Length:193 Identity:36/193 - (18%)
Similarity:64/193 - (33%) Gaps:76/193 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RLGELKPYGGRAKYYASIPDTLKVRKDTLAVLNTFRDMLAGGELDTAENKTFPSAKRMR------ 100
            |:.:|:|                  .:||||.|..|         .|:.|....|:|..      
plant    29 RMDDLQP------------------AETLAVHNQIR---------AADQKLAAHAQRYANVRSQD 66

  Fly   101 -ALQWDSELAYMARTHAATVSFMHSECRSTLRFPLAGEVLALSPPVGHRLSLTELLRMVFAHIFD 164
             |:::.::..|.....|..|..|.:                :|.|:..:...||       ..:.
plant    67 CAMKYSTDGTYGENIAAGWVQPMDT----------------MSGPIATKFWFTE-------KPYY 108

  Fly   165 EYKTVQDPQSFARRFDSKRDYSVGHFSIIVNDRVSRVGCGFAVGSNCEKDGKVGFCHFLTCHF 227
            .|.|            :|.....||::.||.::.:.:|||..   .|.|:..|    ::.|::
plant   109 NYAT------------NKCSEPCGHYTQIVANQSTHLGCGTV---RCFKNEYV----WVVCNY 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 33/169 (20%)
AT2G19980NP_179588.1 SCP 35..165 CDD:294090 34/187 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.