DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and PR1

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_179068.1 Gene:PR1 / 815949 AraportID:AT2G14610 Length:161 Species:Arabidopsis thaliana


Alignment Length:147 Identity:28/147 - (19%)
Similarity:54/147 - (36%) Gaps:50/147 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LQWDSELAYMARTHAATVSFMHSECRSTLRFPLAGEVLALSPPVGHRLS--LTELLRMVFAHIFD 164
            :|||..:|..||::|..   :...||          ::....|.|..|:  ..:|..:...::: 
plant    49 MQWDERVAAYARSYAEQ---LRGNCR----------LIHSGGPYGENLAWGSGDLSGVSAVNMW- 99

  Fly   165 EYKTVQDPQSFARRFDSKRDYS---------VGHFSIIVNDRVSRVGCGFAVGSNCEKDGKVGFC 220
                          ...|.:|:         .||::.:|..:..|:||...   .|...|.:   
plant   100 --------------VSEKANYNYAANTCNGVCGHYTQVVWRKSVRLGCAKV---RCNNGGTI--- 144

  Fly   221 HFLTCHFDYTNVNGSYV 237
              ::|::|   ..|:||
plant   145 --ISCNYD---PRGNYV 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 24/136 (18%)
PR1NP_179068.1 SCP_PR-1_like 30..161 CDD:240181 28/147 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.