DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and PRB1

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_179064.1 Gene:PRB1 / 815945 AraportID:AT2G14580 Length:161 Species:Arabidopsis thaliana


Alignment Length:135 Identity:33/135 - (24%)
Similarity:54/135 - (40%) Gaps:31/135 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LQWDSELAYMARTHAATVSFMHSECRSTLRFPLAGEVLALSPPVGHRLSLTELLRMVFAHIFDEY 166
            :|||..||..||.:|   :.:..:||........||.||.|   |..||....:.:         
plant    49 MQWDEGLAAYARNYA---NQLKGDCRLVHSRGPYGENLAKS---GGDLSGVAAVNL--------- 98

  Fly   167 KTVQDPQSFARRFDSKRDYSV-GHFSIIVNDRVSRVGCGFAVGSNCEKDGKVGFCHFLTCHFD-- 228
             .|.:..::  .:|:.....| ||::.:|.....|:||...   .|...|.:     ::|::|  
plant    99 -WVNEKANY--NYDTNTCNGVCGHYTQVVWRNSVRLGCAKV---RCNNGGTI-----ISCNYDPP 152

  Fly   229 --YTN 231
              |.|
plant   153 GNYAN 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 30/126 (24%)
PRB1NP_179064.1 CAP_PR-1 30..161 CDD:349400 33/135 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.