DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and Crispld2

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001297564.1 Gene:Crispld2 / 78892 MGIID:1926142 Length:495 Species:Mus musculus


Alignment Length:271 Identity:49/271 - (18%)
Similarity:95/271 - (35%) Gaps:85/271 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLLAGLLLLLLPMVAGYNYCNNRTHVCDLAQRKHFMCRLGELKPYGGRAKYYASIPDTLKVRKDT 69
            ::|.||.||:..:.|  .:..|.|.:      :..:.:....:|:   ::...:||  :..|::.
Mouse     8 MVLMGLALLVCGVQA--FFLPNTTSL------EKLLSKYQHAEPH---SRVRRAIP--MSDRQEI 59

  Fly    70 LAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAATVSFMHSECRSTLRFPL 134
            |.:.|..|            .:.:|.|..|..:.||.||...|...|....:.|.          
Mouse    60 LMLHNKLR------------GQVYPPASNMEHMTWDEELERSAAAWAHRCLWEHG---------- 102

  Fly   135 AGEVLALSPPVGHRLSLTELLRMVFAHIFDEYKTVQDP----QSFARRFDSKRDYS--------- 186
                     |.|       |||.:..::...:...:.|    ||:   :|..:||:         
Mouse   103 ---------PAG-------LLRSIGQNLAVHWGRYRSPGFHVQSW---YDEVKDYTYPYPHECTP 148

  Fly   187 ----------VGHFSIIVNDRVSRVGCGFAVGSNCEKDGKV-GFCHFLTCHFDYTNVNGSYV--- 237
                      ..|::.:|....:::||......|....|.. ....:|.|::   :..|:::   
Mouse   149 RCRERCSGPMCTHYTQMVWATTNKIGCAVHTCRNMNVWGDTWENAVYLVCNY---SPKGNWIGEA 210

  Fly   238 -YKTGKATTGC 247
             ||.|:..:.|
Mouse   211 PYKHGRPCSEC 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 33/185 (18%)
Crispld2NP_001297564.1 CAP 56..201 CDD:381818 33/188 (18%)
LCCL 284..368 CDD:128866
LCCL 387..486 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841298
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.