DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and Crisp4

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001333976.1 Gene:Crisp4 / 78081 MGIID:1925331 Length:293 Species:Mus musculus


Alignment Length:223 Identity:45/223 - (20%)
Similarity:74/223 - (33%) Gaps:54/223 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 RAKYYASIPDT-LKVRKDTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTH 115
            ||.|...|.:: .:.:::.:...|.||            .|..|.|:.|..:.|.|..|..||..
Mouse    70 RALYNKLITESQTEPQEEIVNTHNAFR------------RKVSPPARNMLKVSWSSAAAENARIL 122

  Fly   116 AATVSFMHSECRSTLRFP--LAGEVLALSPPVGHRLSLTELLRMVFAHI----FDEYKTVQDPQS 174
            |.......|:.... |.|  ..||.:.:.   .:..|.::::.:.|...    :.|:.:..|   
Mouse   123 ARYCDKSDSDSLER-RLPNTFCGENMLME---HYPSSWSKVIEIWFNESKYFKYGEWPSTDD--- 180

  Fly   175 FARRFDSKRDYSVGHFSIIVNDRVSRVGCGFAVGSNCEKDGKVGF---CHFLTCHFDYTNVNGSY 236
                     |....|::.:|......|||..|.   |.:.....:   ||:  ||........:.
Mouse   181 ---------DIETDHYTQMVWASTYLVGCDVAA---CRRQKAATYLYVCHY--CHEGNHQDTLNM 231

  Fly   237 VYKTGKATTGCNDWKTIASIKYSNLCEN 264
            .||.|.....|           .|.||:
Mouse   232 PYKEGSPCDDC-----------PNNCED 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 34/170 (20%)
Crisp4NP_001333976.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841340
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.