DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and CRISP2

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_005249406.1 Gene:CRISP2 / 7180 HGNCID:12024 Length:278 Species:Homo sapiens


Alignment Length:234 Identity:46/234 - (19%)
Similarity:76/234 - (32%) Gaps:65/234 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LGELKPYGGRAKYYASIPDTLKVRKDTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSE 107
            |..|...|....:.|.:...|:|:::.:...|..|..::            |.|..|..::|..|
Human    14 LPSLPAEGKDPAFTALLTTQLQVQREIVNKHNELRKAVS------------PPASNMLKMEWSRE 66

  Fly   108 LAYMARTHAATVSFMHSECRSTLRFPLAGEVLALSPPVGHRLSLTELLRMVFAHIFDEYKTVQDP 172
            :...|:..|...:..||:..........||.|.:|                           .||
Human    67 VTTNAQRWANKCTLQHSDPEDRKTSTRCGENLYMS---------------------------SDP 104

  Fly   173 QSFARRFDSKRD------YS---------VGHFSIIVNDRVSRVGCGFAVGSNCEKDGKVGFCHF 222
            .|::....|..|      |.         |||::.:|.....:||||.|...|.:     ...::
Human   105 TSWSSAIQSWYDEILDFVYGVGPKSPNAVVGHYTQLVWYSTYQVGCGIAYCPNQD-----SLKYY 164

  Fly   223 LTCHFDYTNVNGSYVYKTGKATTGCNDWKTIASIKYSNL 261
            ..|  .|.....:|:.|    ..|.|.||....:::..|
Human   165 YVC--QYCPAMKTYLNK----REGINVWKCFLRLRHFQL 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 32/176 (18%)
CRISP2XP_005249406.1 SCP_CRISP 35..172 CDD:240183 34/182 (19%)
Crisp 224..278 CDD:285731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151284
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.