DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and Glipr1l2

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_080499.1 Gene:Glipr1l2 / 67537 MGIID:1914787 Length:332 Species:Mus musculus


Alignment Length:187 Identity:39/187 - (20%)
Similarity:66/187 - (35%) Gaps:41/187 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 FPSAKRMRALQWDSELAYMAR-----------THAATVSFMHSECRSTLRFPLAGEVLALSPPVG 146
            ||....:|.:.||..|:..||           ||...:...|..      |...||.:.:.|.  
Mouse    66 FPPGVNLRFMTWDVALSRTARAWGKKCMYSRNTHLDKLHESHPV------FTEIGENMWVGPV-- 122

  Fly   147 HRLSLTELLRMVFAHIFDEYKTVQDPQSFARRFDS-KRDYSVGHFSIIVNDRVSRVGCGFAVGSN 210
            ...::|..:|          ...::.:|::...|: ..|.:..|:..:|.|...:|||..   ::
Mouse   123 EDFTVTTAIR----------SWHEERKSYSYLNDTCVEDQNCSHYIQLVWDSSYKVGCAV---TS 174

  Fly   211 CEKDGKVGFCH--FLTCHFDYTNVNGSYVYKTGKATTGCNDWKTIASIKYSNLCENT 265
            |.:.|  ||.|  ...|::..........|:.|:..:.|.........    ||.||
Mouse   175 CARAG--GFTHAALFICNYAPGGTLTRRPYQAGQFCSRCGPGDQCTDY----LCSNT 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 32/148 (22%)
Glipr1l2NP_080499.1 SCP 49..194 CDD:294090 32/150 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841424
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.