DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and crispld2

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001027499.1 Gene:crispld2 / 613091 XenbaseID:XB-GENE-985953 Length:500 Species:Xenopus tropicalis


Alignment Length:291 Identity:60/291 - (20%)
Similarity:93/291 - (31%) Gaps:97/291 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLLAGLLLLLLPMVAGYNYCNNRTHVCDLAQRKHFMCRLGELKPYGGRAKYYASIPDTLKVRKDT 69
            :|..||..||      ...|     .|..|....|:..|  |..|          .||....:..
 Frog     8 ILSLGLFFLL------KEQC-----YCIFAPNSTFLENL--LNKY----------KDTTPHSRTR 49

  Fly    70 LAVLNTFRDMLAGGELDTAENK----TFPSAKRMRALQWDSELAYMARTHAATVSFMHSECRSTL 130
            .|:|.|.::     |:....||    ..|||..|..:.||.||...|...|....:.|..     
 Frog    50 RAILRTDKE-----EIIQLHNKLRGQVHPSASNMEYMTWDDELEKSAEAWAEECIWEHGP----- 104

  Fly   131 RFPLAGEVLALSPPVGHRLSLTELLRMVFAHIFDEYKTVQDPQSFARRFDSKRDYS--------- 186
                    .||...:|..|::         | :..|:  |........:|..:||:         
 Frog   105 --------TALLMSIGQNLAV---------H-WGRYR--QPAYHVQSWYDEVKDYTYPYPHECNP 149

  Fly   187 ----------VGHFSIIVNDRVSRVGCGFAVGSNCEKDGKVG----FCHFLTCHFDYTNVNGSYV 237
                      ..|::.||....::|||...|   |::....|    ...:|.|::   :..|:::
 Frog   150 YCPERCSGPMCTHYTQIVWATTTKVGCAVNV---CKRMNVWGDIWENAVYLVCNY---SPKGNWI 208

  Fly   238 ----YKTGKATTGCNDWKTIASIKYSNLCEN 264
                ||.|:..:.|..       .|...|:|
 Frog   209 GEAPYKNGRPCSECPP-------SYGGNCQN 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 38/188 (20%)
crispld2NP_001027499.1 SCP_euk 57..202 CDD:240180 35/180 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..281
LCCL 289..373 CDD:128866
LCCL 392..490 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.