DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and crispl

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001025526.1 Gene:crispl / 594930 XenbaseID:XB-GENE-5768874 Length:314 Species:Xenopus tropicalis


Alignment Length:276 Identity:63/276 - (22%)
Similarity:94/276 - (34%) Gaps:77/276 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LPMVAGY-NYCNNRT-HVCDLAQRKHFMCRLGELKPYGGR--------------AKYYASIPDTL 63
            :|..|.: :|.|:.| |....::||.          .|||              ..:.|...|..
 Frog    51 IPTAAPFSDYGNDTTQHPAGGSRRKR----------AGGRKITIPPENIEKMKNVPFSALSTDLE 105

  Fly    64 KVRKDTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAATVSFMHS-ECR 127
            ..|:..|.|.|..|            ....|....|..:.|....|..|...|.:....|| :..
 Frog   106 SNRQSILNVHNELR------------RNANPPPSNMLKMVWSDLAAKSAAKWANSCKQYHSLKPE 158

  Fly   128 STLRFPLAGEVLALSPPVGHRLSLTELLRMVFAHIFDEYKTVQDPQSFARRFDSKRDYSVG---- 188
            .|:.....||.|.::   .::.|..:::|..::.|.|          |.....:|   .||    
 Frog   159 RTIPGFSCGENLFMA---SYKASWEDVIRAFYSEIED----------FLYGKGAK---EVGLQIL 207

  Fly   189 HFSIIVNDRVSRVGCGFAVGSNCE-KDGKVGFCHFLTCHF----DYTNVNGSYVYKTGKATTGCN 248
            ||:.::......|||..|   .|. .|..:.|  :..||:    :|.||  ...|||||.   |.
 Frog   208 HFTQVMWFSSWLVGCAAA---QCPITDHSLEF--YFVCHYAPAGNYGNV--GIPYKTGKP---CE 262

  Fly   249 DWKTIASIKYSNLCEN 264
            |.|:...   :.||.|
 Frog   263 DCKSSCE---NGLCTN 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 36/171 (21%)
crisplNP_001025526.1 CAP_CRISP 106..245 CDD:349402 36/171 (21%)
Crisp 261..314 CDD:369954 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.