DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and pi15a

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001153449.1 Gene:pi15a / 561978 ZFINID:ZDB-GENE-040724-135 Length:260 Species:Danio rerio


Alignment Length:240 Identity:56/240 - (23%)
Similarity:87/240 - (36%) Gaps:80/240 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ASIPDTLKVR----KDTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAA 117
            |:||.|.:.|    .|.||:|: :.:.:.|        |.||.|..|..:.||..||..|...|:
Zfish    53 ANIPKTRRKRYISQNDMLAILD-YHNKVRG--------KVFPPASNMEYMVWDDTLAKTAEQWAS 108

  Fly   118 TVSFMHSECRSTLRFPLAGEVLALSPPVGHRLSLTELLRMVFAHIFDEYKTVQDPQSFARRFDSK 182
            |..:.|.. |:.|||  .|:  .||...|...|:.:|::    ...||.|...        |...
Zfish   109 TCIWEHGP-RNLLRF--LGQ--NLSVRTGRYRSILQLVK----PWHDEVKDYS--------FPYP 156

  Fly   183 RDYS-----------VGHFSIIVNDRVSRVGCGFAVGSNCEKDGKVGFCH-------------FL 223
            ||.:           ..|::.:|....::|||.            :..||             :|
Zfish   157 RDCNPRCPLKCYGPMCTHYTQMVWATSNKVGCA------------INTCHNMNVWGSVWKRATYL 209

  Fly   224 TCHFDYTNVNGSYV----YKTGKATTGCNDWKTIASIKYSNLCEN 264
            .|::   :..|:::    ||.|...:.|..       .|...|.|
Zfish   210 VCNY---SPKGNWIGEAPYKVGVPCSMCPP-------SYGGSCSN 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 44/189 (23%)
pi15aNP_001153449.1 SCP_euk 71..214 CDD:240180 41/183 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585795
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.