DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and pi15b

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_684600.2 Gene:pi15b / 556658 ZFINID:ZDB-GENE-070912-590 Length:257 Species:Danio rerio


Alignment Length:291 Identity:61/291 - (20%)
Similarity:94/291 - (32%) Gaps:77/291 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSILLLAGLLLLLLPMVAGYNYCNNRTHVCDLAQRKHFMCRLGE-----LKPYGGRAKYYASIP 60
            |.::.....|||:.:...|......|.|..............||:     .||...|.:|.:   
Zfish     1 MKTVNFFTDLLLVFIASDASAWVIRNATETQTGTNLTFSTSELGDDQGIGSKPKSRRKRYIS--- 62

  Fly    61 DTLKVRKDTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAATVSFMHSE 125
                 :.|.:|:|:....:.|         ..||.|..|..:.||..||..|...|||..:.|  
Zfish    63 -----QSDMIAILDYHNKVRA---------NVFPPAANMEYMLWDDGLARSAEAWAATCIWEH-- 111

  Fly   126 CRSTLRFPLAGEVLALSPP-----VGHRLSL-TELLRMVFAHIFDEYKTVQDPQSFARRFDSKRD 184
                            .||     :|..||: |...|.:...:...|..|:|     ..|...||
Zfish   112 ----------------GPPYLLRYLGQNLSVRTGNYRSILQLVKPWYDEVRD-----YMFPYPRD 155

  Fly   185 YS-----------VGHFSIIVNDRVSRVGCGFAVGSNCEKDGKV-GFCHFLTCHFDYTNVNGSYV 237
            .:           ..|::.:|....:||||......|....|.| ....:|.|::   :..|:::
Zfish   156 CNPHCPMRCYGPMCTHYTQMVWASSNRVGCAIQTCFNMVVWGAVWREATYLVCNY---SPKGNWI 217

  Fly   238 ----YKTGKATTGCNDWKTIASIKYSNLCEN 264
                |:.|...:.|..       .|...|.|
Zfish   218 GEAPYRVGVPCSACPP-------SYGGSCSN 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 41/179 (23%)
pi15bXP_684600.2 SCP_euk 68..211 CDD:240180 40/177 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585774
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.