DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and Glipr1l3

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001360960.1 Gene:Glipr1l3 / 544736 MGIID:3620621 Length:236 Species:Mus musculus


Alignment Length:238 Identity:47/238 - (19%)
Similarity:79/238 - (33%) Gaps:73/238 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KPYGGRAKYYASIPDTLKVRKDTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYM 111
            |.:|.......||.|.    |...|.||...::         ..|..|.|..|..:.||.:||.:
Mouse    24 KAFGNDLPRVPSILDP----KFIDAFLNIHNEL---------RRKVQPPAADMNQVIWDQKLAKL 75

  Fly   112 ARTHAATVSFMHSECRS-----TLRFPLAGEVLALSPPVGHRLSLTELLRMVFAHIFDEYKTVQD 171
            |:.........|:.|.|     .|.:...||.:.|.                      |.:|  .
Mouse    76 AKAWTRECKLGHNPCTSKQYGCLLDYDFIGENIYLG----------------------EIET--Q 116

  Fly   172 PQSFARR-FDSKRDYS---------VGHFSIIVNDRVSRVGCGFAVGSNCEKDGKVGFCHFLTCH 226
            |:..... ::...||:         ..:::.:|..:..::||..   |||....:.....|: |:
Mouse   117 PEDVVNNWYNENTDYNFVDNTCSKICRNYTQLVWAKTFKIGCAV---SNCPNLTRYSAGLFV-CN 177

  Fly   227 FDYTNVNGSYV----YKTGKATTGCNDWKTIASIKYSNLCENT 265
            :..|   |:::    |:.|...:.|...|          |||:
Mouse   178 YSPT---GNFLDFRPYRKGDPCSMCGQRK----------CENS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 33/176 (19%)
Glipr1l3NP_001360960.1 CAP 40..182 CDD:381818 34/181 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841395
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.