DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and PI15

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001311332.1 Gene:PI15 / 51050 HGNCID:8946 Length:258 Species:Homo sapiens


Alignment Length:200 Identity:52/200 - (26%)
Similarity:79/200 - (39%) Gaps:27/200 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ASIPDTLKVR----KDTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAA 117
            |.||...:.|    .|.:|:|: :.:.:.|        |.||.|..|..:.||..||..|...||
Human    51 ADIPKARRKRYISQNDMIAILD-YHNQVRG--------KVFPPAANMEYMVWDENLAKSAEAWAA 106

  Fly   118 TVSFMHSECRSTLRFPLAGEVLALSPPVGHRLSLTELLRMVFAHIFD---EYKTVQDPQSFARRF 179
            |..:.|.. ...|||  .|:  .||...|...|:.:|::..:..:.|   .|....:|:...|.|
Human   107 TCIWDHGP-SYLLRF--LGQ--NLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCF 166

  Fly   180 DSKRDYSVGHFSIIVNDRVSRVGCGFAVGSNCEKDGKV-GFCHFLTCHF-DYTNVNGSYVYKTGK 242
            ..    ...|::.:|....:|:||......|....|.| ....:|.|:: ...|..|...||.|.
Human   167 GP----MCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGV 227

  Fly   243 ATTGC 247
            ..:.|
Human   228 PCSSC 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 43/170 (25%)
PI15NP_001311332.1 CAP_PI15 67..212 CDD:349408 41/162 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151200
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.