DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and Ag5r

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001245671.1 Gene:Ag5r / 44631 FlyBaseID:FBgn0015010 Length:256 Species:Drosophila melanogaster


Alignment Length:283 Identity:78/283 - (27%)
Similarity:117/283 - (41%) Gaps:61/283 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLLLLPMVAGYNYCNNRTHVCDLAQRKHFMCRLGELKPYG--GRAKYYASIPD-----TL-KVRK 67
            |.|...:.:..:||..             .|  |..|..|  ....:.:|.|.     || ...|
  Fly    10 LSLAFGIASATDYCKK-------------SC--GSTKNLGCDNNGAWASSCPSDATLLTLSSAEK 59

  Fly    68 DTL-AVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAATVSFMHSECRSTLR 131
            |.| |..|.:|:.:|||     .|....:|.||..::|:.||||:|..:..:....|..|.:|..
  Fly    60 DALVARTNEYRNHIAGG-----LNANLSAACRMATIKWNDELAYLASLNVKSCQMKHDGCHNTDA 119

  Fly   132 FPLAGEVLALSPPVGH--RLSLTELLRMVFAHIFDEYKTVQDPQSFARRFDSKRDY---SVGHFS 191
            |..:|:.||.   :|:  .|::|..|.......:||  .|...|::...:.|  :|   ::|||:
  Fly   120 FDWSGQNLAW---MGYYNPLNVTHYLEWGVDMWYDE--AVYTKQAYIDAYPS--NYNGPAIGHFT 177

  Fly   192 IIVNDRVSRVGCGFAVGSNCEKDGKVGFCHFLTCHFDYTNVNGSYVYKT-----GKATTGCNDWK 251
            ::|.||.:.|||..|..|   ..|:......|.|::..|||.|..:|.:     .|.|||.|.  
  Fly   178 VLVADRNTEVGCAAATYS---VSGQSYKAFLLACNYAATNVLGIKMYSSCSKAASKCTTGTNP-- 237

  Fly   252 TIASIKYSNLCE-----NTGEIF 269
                 ||..||.     |...:|
  Fly   238 -----KYKYLCSAKEEYNVNNLF 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 50/167 (30%)
Ag5rNP_001245671.1 SCP_euk 59..211 CDD:240180 50/166 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440690
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.