DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and scpr-A

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster


Alignment Length:289 Identity:83/289 - (28%)
Similarity:131/289 - (45%) Gaps:56/289 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TSILLLAGLLLLLLPMVAGYNYCNNRTHVCDLAQRKHFMCRLGELKPYGGRAKYYASIP-DTLKV 65
            |.:|.|  :||.::.:.:..:||...|     ...||..|        ..:..:..:.| |..:|
  Fly     4 TKVLQL--ILLAVVAISSAVDYCALPT-----CLDKHVAC--------NNKGNFSENCPKDVREV 53

  Fly    66 R-----KDTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAATVSFMHSE 125
            :     |..|.:.|..|:.:|||:::     ..|.|.||..:.|..||:::|..:..|...:..:
  Fly    54 KIEPHHKLILNLFNELRNNVAGGKIE-----GLPKAVRMAKMSWCEELSHLALLNVKTCESLPDK 113

  Fly   126 CRSTLRFPLAGEVLALSPPVGHRLSLT--ELLRMVFAHIFDEYKTVQDPQ---SFARRFDSKRDY 185
            ||||.||..||:..||....|.....|  |:::....:.|.| ::...|:   ||.....:|   
  Fly   114 CRSTERFAYAGQNNALFQYSGAETEYTDAEIIKEEIENWFAE-RSNASPEILASFPEELPNK--- 174

  Fly   186 SVGHFSIIVNDRVSRVGCGFAVGSNCEKDGKVGFCHF-LTCHFDYTNVNGSYVYKTG-KATTGCN 248
            :|..|:|.|.::.:.|||. ||     :..:..:.|| |||:|..:|:.|..||..| ||||||.
  Fly   175 AVTKFTIAVAEKNTHVGCA-AV-----RFSRDFYNHFVLTCNFATSNIVGQPVYTPGEKATTGCK 233

  Fly   249 DWKTIASIKYSNLC------------ENT 265
            : :..|:..|.|||            |||
  Fly   234 N-RYGAAYDYPNLCYAKEIYDNEKVIENT 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 49/172 (28%)
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 49/166 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440627
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.