DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and scpr-B

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster


Alignment Length:281 Identity:82/281 - (29%)
Similarity:125/281 - (44%) Gaps:54/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLLLPMVAGYNYCNNRTHVCDLAQRKHFMCRLGELKPYGGRAKYYASIP-DTLKVR-----KD 68
            ||..||.:....:||...|     ...||..|        ..:..:..:.| |..:|:     |.
  Fly     8 LLTSLLGISLAADYCALPT-----CLDKHIAC--------NNKGNFSENCPKDVREVKIEPHHKL 59

  Fly    69 TLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAATVSFMHSECRSTLRFP 133
            .|.:.|..|:.:|||:::     ..|.|.||..:.|..||:::|..:..|...:..:||||.||.
  Fly    60 ILNLFNELRNNVAGGKIE-----GLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFA 119

  Fly   134 LAGEVLALSPPVGHRLSLT--ELLRMVFAHIFDEYKTVQDPQ---SFARRFDSKRDYSVGHFSII 193
            .||:..||....|.....|  |:::....:.|.| ::...|:   ||.....:|   :|..|:|.
  Fly   120 YAGQNNALFQYSGAETEYTDAEIIKEQIENWFAE-RSNASPEILASFPEELPNK---AVTKFTIA 180

  Fly   194 VNDRVSRVGCGFAVGSNCEKDGKVGFCHF-LTCHFDYTNVNGSYVYKTG-KATTGCNDWKTIASI 256
            |.::.:.|||. ||     :..:..:.|| |||:|..:|:.|..||..| ||||||.: :..|:.
  Fly   181 VAEKNTHVGCA-AV-----RFSRDFYNHFVLTCNFATSNIVGQPVYTPGEKATTGCKN-RYGAAY 238

  Fly   257 KYSNLC------------ENT 265
            .|.|||            |||
  Fly   239 DYPNLCYAKEIYDNEKVIENT 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 49/172 (28%)
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 49/166 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440655
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.