DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and scpr-C

DIOPT Version :10

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_650053.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster


Alignment Length:288 Identity:83/288 - (28%)
Similarity:129/288 - (44%) Gaps:58/288 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SILLLAGLLLLLLPMVAGYNYCNNRTHVCDLAQRKHFMCRLGELKPYGGRAKYYASIP-DTLKVR 66
            |::||..||.:.|    ..:||...|     ...||..|        ..:..:..:.| |..:|:
  Fly     5 SLILLTSLLGISL----AADYCALPT-----CLDKHIAC--------NNKGNFSENCPKDVREVK 52

  Fly    67 -----KDTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAATVSFMHSEC 126
                 |..|.:.|..|:.:|||:::     ..|.|.||..:.|..||:::|..:..|...:..:|
  Fly    53 IEPHHKLILNLFNELRNNVAGGKIE-----GLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKC 112

  Fly   127 RSTLRFPLAGEVLALSPPVGHRLSLT--ELLRMVFAHIFDEYKTVQDPQ---SFARRFDSKRDYS 186
            |||.||..||:..|:....|.....|  |:::....:.|.| ::...|:   ||.....:|   :
  Fly   113 RSTERFAYAGQNNAVFQYSGAETEYTDAEIIKEQIENWFAE-RSNASPEILASFPEELPNK---A 173

  Fly   187 VGHFSIIVNDRVSRVGCGFAVGSNCEKDGKVGFCHF-LTCHFDYTNVNGSYVYKTG-KATTGCND 249
            |..|:|.|.::.:.|||. ||     :..:..:.|| |||:|..:|:.|..||..| ||||||.:
  Fly   174 VTKFTIAVAEKNTHVGCA-AV-----RFSRDFYNHFVLTCNFATSNIVGQPVYTPGEKATTGCKN 232

  Fly   250 WKTIASIKYSNLC------------ENT 265
             :..|:..|.|||            |||
  Fly   233 -RYGAAYDYPNLCYAKEIYDNEKVIENT 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 CAP_euk 66..228 CDD:349399 48/172 (28%)
scpr-CNP_650053.1 CAP_euk 57..210 CDD:349399 48/167 (29%)

Return to query results.
Submit another query.