DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and CG11977

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster


Alignment Length:235 Identity:58/235 - (24%)
Similarity:91/235 - (38%) Gaps:42/235 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NYCNNRTHVCDLAQRKHFMCRLGELKPYGGRAKYYASIPDTLKVRKDTLAVLNTFRDMLAGGELD 86
            :|||  ..:|. |.:||..|.........||......:.|   .|.|.:..:|.||..|..|   
  Fly    43 DYCN--ADICP-ANKKHITCGFKFWSTKCGRNHEGVRMSD---YRYDIVRNVNNFRRKLEWG--- 98

  Fly    87 TAENKTFPSAKRMRALQWDSELAYMA-RTHAATVSFMHSECRSTLRFPLAGE----VLALSPPVG 146
               ....|.|.:.:.::||.||:.|| |.....:....|.|.:|..:...||    |...:...|
  Fly    99 ---LGNLPRAVKFKNIKWDDELSVMAMRVSNQCLQHTFSPCVNTFLYKDVGESSDFVKVQNTSKG 160

  Fly   147 HRLSLTELLRMVFAHIFDEYKTVQDPQSFARRFD--SKRDYSVGHFSIIVNDRVSRVGCGFAVGS 209
            ..:       :.|.:::.||..:..| |:...|.  :.:|..: .|:.::.::..::|||..   
  Fly   161 FNV-------ISFLNMWFEYHKMMKP-SYVNNFPNIAPQDRLI-IFANLIYEKNKKMGCGMV--- 213

  Fly   210 NCEKDGKVGFCHFLTCHFDYTNVNGSYVYKTGKATTGCND 249
                  |.|...||||.||........:|     ||..||
  Fly   214 ------KSGQGRFLTCLFDKKIKPNQKLY-----TTRLND 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 40/168 (24%)
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 40/168 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.