DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and crisp1.7

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_989314.1 Gene:crisp1.7 / 394939 XenbaseID:XB-GENE-5779195 Length:244 Species:Xenopus tropicalis


Alignment Length:239 Identity:49/239 - (20%)
Similarity:84/239 - (35%) Gaps:85/239 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PYGGRAKYYASIPDTLKVRKDTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMA 112
            |:...:..||:      .|:..:.:.|.:|            ....|:|..|..:.|..|....|
 Frog    22 PFSSLSTRYAT------NRQKIVDIHNAYR------------RSANPTASNMLKMSWSIEAENNA 68

  Fly   113 RTHAATVSFMHSECRSTLRFPLA--------GEVLALSPPVGHRLSLTELLRMVFAHIFDEYKTV 169
            :..|.|.:..||:       |.|        ||.|.:|   .:..|..|::              
 Frog    69 KNWATTCNQYHSQ-------PAARQIANITCGENLFMS---SYPASWEEVI-------------- 109

  Fly   170 QDPQSFARRFDSKRDYSV---------GHFSIIVNDRVSRVGCGFAVGSNCEKDGKVGFCHFLTC 225
               ||....:|: .:|.|         ||::.::..:..|:||   ..:.|..|| |...::..|
 Frog   110 ---QSLHSEYDN-FEYGVGAKAVGLVIGHYTQVMWYKSYRIGC---YCTECPNDG-VRLKYYYVC 166

  Fly   226 HF----DYTN-VNGSYVYKTGKATTGCNDWKTIASIKYSNLCEN 264
            .:    :|.: :|  |.||:|.:...|.|           .|:|
 Frog   167 QYYPAGNYADRIN--YPYKSGPSCADCPD-----------ACDN 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 36/182 (20%)
crisp1.7NP_989314.1 CAP_CRISP 32..171 CDD:349402 36/188 (19%)
Crisp 188..243 CDD:369954 4/21 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.