DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and glipr1b

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_005159058.1 Gene:glipr1b / 393547 ZFINID:ZDB-GENE-040426-1459 Length:255 Species:Danio rerio


Alignment Length:206 Identity:44/206 - (21%)
Similarity:67/206 - (32%) Gaps:64/206 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 DTAENKTFPSAKRMRAL--------QWDSELAYMARTHAATVSFMHSECRSTLRFPL---AGEVL 139
            :|...:..|.|...|::        .||.|||..||..|......|.........||   .||.:
Zfish    42 NTHRARVSPPAAGARSMVRQVFGMQSWDKELAKGARDRARHCKGSHYPSLGHFGHPLFGWMGENI 106

  Fly   140 ALSPPVGHRLSLTELLRMVFAHIFDEYKTVQDPQSFARRFDSKRDYSV---------GHFSIIVN 195
            .|..|                  |..:..    ::...|:..:..|||         ||::.::.
Zfish   107 WLGSP------------------FSAFSV----ENAVHRWSKEGAYSVKNNNCSRLCGHYAQLMW 149

  Fly   196 DRVSRVGCGFAVGSNCEKDGKVGFCHFLT--------CHF-DYTNVNGSYVYKTGKATTGCNDWK 251
            ....::||...|   |.|    |..:|.|        |:: |...|:|...| .....:||.   
Zfish   150 STSFKMGCAVNV---CSK----GIENFSTHPESTIFVCNYGDTGQVHGVTPY-MAMGCSGCG--- 203

  Fly   252 TIASIKYSNLC 262
              :.|...|:|
Zfish   204 --SEICRDNVC 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 35/170 (21%)
glipr1bXP_005159058.1 SCP 32..185 CDD:294090 35/171 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.