DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and crispld1b

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_009296842.1 Gene:crispld1b / 393442 ZFINID:ZDB-GENE-040426-1204 Length:509 Species:Danio rerio


Alignment Length:288 Identity:55/288 - (19%)
Similarity:90/288 - (31%) Gaps:87/288 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLAGLLLLLLPMVAGYNYCNNRTHVCDLAQRKHFMCR---LGELKPYGGRAKYYASIPDTLKVRK 67
            |.:|.:||:...........|.||:..:.::  :|.:   ..:.|..|.||           :.:
Zfish     9 LFSGFVLLVTVQTVVSMVIPNATHLEAILEK--YMDKDETWWQSKSRGKRA-----------ISQ 60

  Fly    68 DTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAATVSFMHSECRSTLRF 132
            ..:.::....:.|.|        :.:|.|..|..:.||:||...|...|.|..:.|.......|.
Zfish    61 SDMQLILDLHNKLRG--------QVYPPASNMEYMVWDTELERSAEHWAHTCLWEHGPSHLLTRI 117

  Fly   133 PLAGEVLAL-----SPPVGHRLSLTELLRMVFAHIFDEYKTVQDPQSFARRFDSKRDYS------ 186
               |:.|..     .||..|                     ||      ..:|..||:|      
Zfish   118 ---GQNLGAHWGRDRPPTFH---------------------VQ------AWYDEVRDFSYPYPQE 152

  Fly   187 -------------VGHFSIIVNDRVSRVGCGFAVGSNCEKDGKV-GFCHFLTCHFDYT-NVNGSY 236
                         ..|::.:|....:::||...|..|....|.: ....:|.|::... |..|..
Zfish   153 CNPHCPYRCSGPVCTHYTQLVWATSNKIGCAINVCYNMNVWGMIWAKAVYLVCNYSPPGNWWGHA 217

  Fly   237 VYKTGKATTGCNDWKTIASIKYSNLCEN 264
            .||.|...:.|..       .|...|.|
Zfish   218 PYKHGTPCSACPP-------SYGGGCRN 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 34/186 (18%)
crispld1bXP_009296842.1 SCP_euk 64..208 CDD:240180 34/181 (19%)
LCCL 301..385 CDD:128866
LCCL 404..501 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585732
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.