DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and CG17974

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster


Alignment Length:287 Identity:71/287 - (24%)
Similarity:122/287 - (42%) Gaps:50/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSILLLAGLLLLLLPMVAG--YNYC------NNRTHV-CDLAQRKHFMCRLGELKPYGGRAKYY 56
            |:|.|:...:..|:..::..  |::|      |...|: |......|..|:              
  Fly     1 MSSPLICLAIFQLIFQLILAKDYSWCDPDLCGNGVRHIACRTTGNFHRRCQ-------------- 51

  Fly    57 ASIPDTLKV-----RKDTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHA 116
               ||.::|     :.|.|...|..|:.||.|::.    ..:|:| ||..:.||.||.|::..:.
  Fly    52 ---PDAVQVDVSRHKADFLHAHNKRRNFLALGKVP----GYYPAA-RMATMVWDDELQYLSMLNT 108

  Fly   117 ATVSFMHSECRSTLRFPLAGEVL-ALSPPVGHRLSLTELLRMVFAHIFDEYKTVQDPQSFARRFD 180
            .|....|.:|.:|.|:..:|:.| |:..|....:::|.|:.......|:|:..:.  .||...|.
  Fly   109 RTCKLDHDDCHNTYRYANSGQNLCAVWRPRSPHVNVTSLVEECLGLWFNEFDLID--SSFIDSFK 171

  Fly   181 SK---RDYSVGHFSIIVNDRVSRVGCGFAVGSNCEKDGKVGFCHFLTCHFDYTNVNGSYVYKTGK 242
            ..   .||  |||:.:..|:...|||  ::......|....:.:...|::......|:.||:||:
  Fly   172 VTPIFEDY--GHFAELSVDKNFAVGC--SIMRFTRPDYPSVYIYNFICNYASLYALGAPVYETGR 232

  Fly   243 ATTGCNDWKTIASIKYSNLCENTGEIF 269
            |.:.|...|   |..|..|| :|.|::
  Fly   233 AASRCTTGK---SHFYPGLC-STREVY 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 43/165 (26%)
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 43/165 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440669
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.