DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43775 and Glipr1l2

DIOPT Version :9

Sequence 1:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_002729829.4 Gene:Glipr1l2 / 366890 RGDID:1310205 Length:228 Species:Rattus norvegicus


Alignment Length:173 Identity:38/173 - (21%)
Similarity:58/173 - (33%) Gaps:32/173 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 FPSAKRMRALQWDSELAYMAR-----------THAATVSFMHSECRSTLRFPLAGEVLALSPPVG 146
            ||....:|.:.||..|:..||           ||...|...|..      |...||.:.:.|.  
  Rat    68 FPPGVNLRFMTWDVALSRTARAWGKKCVFERNTHLDKVHESHPV------FTDIGENMWVGPE-- 124

  Fly   147 HRLSLTELLRMVFAHIFDEYKTVQDPQSFARRFDSKRDYSVGHFSIIVNDRVSRVGCGFAVGSNC 211
            ...:.|..:|. :......|..|.|        ....|....|:..:|.|...:|||..   :.|
  Rat   125 KDFTATNAIRS-WHEERKSYNYVND--------TCIEDEDCSHYIQLVWDHSYKVGCAV---TPC 177

  Fly   212 EKDGKVGFCHFLTCHFDYTNVNGSYVYKTGKATTGC-NDWKTI 253
            .|.|.:.:.....|::..........|:.|:..:.| |:.|.|
  Rat   178 AKVGAITYAALFICNYAPGGTLTRRPYQAGQFCSRCTNEEKCI 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 32/145 (22%)
Glipr1l2XP_002729829.4 CAP 51..197 CDD:412178 32/148 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344800
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.